PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00731g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 176aa    MW: 20718.3 Da    PI: 10.4384
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00731g00010.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF38.91.1e-12746746
                              HHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
                    SRF-TF  7 snrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46
                              s r+v + +  +  +KKA+ELSvLCd+  a+iifs++ k+
  Peinf101Scf00731g00010.1  7 SERNVLLHRKVANFFKKAQELSVLCDVGLAIIIFSPDEKI 46
                              56777777777889**********************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004320.003152IPR002100Transcription factor, MADS-box
PfamPF003194.0E-11746IPR002100Transcription factor, MADS-box
PROSITE profilePS5006611.774746IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-14885IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MASNTVSERN VLLHRKVANF FKKAQELSVL CDVGLAIIIF SPDEKIPIMW PSETKVRQIL  60
TSYLGHSEFQ RSKKLVLHEN YLREKLEARV EEIRKMEEKK EMEFLFNQLV MGMSIYDLDA  120
KQLRDSTESK LFFKSFTPNL RLRPKHSSIR TAINTFFAER LPNKPILLVR TLFLTR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ1685131e-152FJ168513.1 Petunia x hybrida type I MADS box transcription factor (MADSy8) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006344961.12e-33PREDICTED: agamous-like MADS-box protein AGL90
RefseqXP_015061001.13e-33PREDICTED: agamous-like MADS-box protein AGL90
TrEMBLB6DT652e-73B6DT65_PETHY; Type I MADS box transcription factor (Fragment)
STRINGSolyc12g016170.1.11e-32(Solanum lycopersicum)
STRINGPGSC0003DMT4000850377e-33(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37820129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26650.14e-12AGAMOUS-like 36